Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowertropicalinsectsbiodiversity
Apple Blossom Branch from Apple tree
Bee from Cartoon animals v coloring book
Steampunk Bee from Steampunk animals coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Cosmos Scabiosoides from Cosmos
Daffodil from Daffodil
Swallow Tail Hummingbird from Hummingbirds
Bee from Cartoon animals coloring book
Lavender from Plants ii coloring book
Orchid Lycaste Aromatica from Orchid
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Iris Motif from Iris
Iris Flower Blossom from Iris
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Black Elderberry from Elderberry
Disa Kewensis Orchid from Orchid
Pollinators of Alaska from Nps
Double Delight Hybrid Tea Rose from Roses
Chrysanthemum 1 from Perennial
Black Orchid from Orchid
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Caterpillar and Buttefly from Caterpillar
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Rhododendron Calendulaceum or Flame Azalea from Azalea
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Realistic Sunflowers from Sunflower
Bumblebee from Bumblebee
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Ladybug from Cartoon animals viii coloring book
Daisy from Simple objects iv coloring book
Bee from Cartoon animals viii coloring book
Chinese Peony from Flowers
Bug from Animals
Black Raspberry from Celebrating wildflowers coloring book
Common Fruit Bats from Realistic animals coloring book
Spring Crocus from Crocus
Butterfly from Cartoon animals vii coloring book
Heliconia Indica from Heliconia
Hibiscus Flower from Hawaii flower
Hibiscus from Realistic flowers
Cherokee Rose from Roses
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Heliconia Psittacorum from Heliconia
Cornflower, Blue Bottle from Cornflowers
Butterfly Flies On A Flower from Flowers
Ranunculus Acris from Buttercup
Scarlet Carnation from Carnation
Hummingbird from Cartoon animals ii coloring book
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Sundowner Rosa Grandiflora from Roses
Grasshopper in Garden from Grasshoppers
Cornflower from Cornflowers
Daffodil Flowers from Daffodil
Clarkia Amoena Farewell to Spring from Godetia
Aquilegia Truncata Red Columbine from Columbine
Cirsium Vulgare or Bull Thistle from Thistle
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Oriental poppy from Perennial
Viola Adunca or Pale Mountain Violet from Violet
Schlumbergera Bloom from Cactus
Pleurothallis Schiedei Orchid from Orchid
Maxillaria Nigrescens Orchid from Orchid
Rosa 'Bahia' Floribunda Rose from Roses
Parade Bush Rose with Butterfly from Roses
Showy Evening Primrose from Primrose
Lathyrus Odoratus or Sweet Pea from Sweet pea
Rose with Thorns from Roses
Western Blue Flax from Celebrating wildflowers coloring book
Cherry Jam Jar from Cherry
Meadow Buttercup, Ranunculus Acris from Buttercup
Watering Can with Flowers from Watering can
201 - 300 of 1,830 Next page
/ 19